Analytical Data
-
Gene name
ZDHHC3
- Application
-
Alternative Names
ZDHHC3; HSD49; Palmitoyltransferase ZDHHC3; Acyltransferase ZDHHC3; Protein DHHC1; Zinc finger DHHC domain-containing Protein 3; DHHC-3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NYG2
-
Expression Region
1-299 aa
-
AA Sequence
MMLIPTHHFRNIERKPEYLQPEKCVPPPYPGPVGTMWFIRDGCGIACAIVTWFLVLYAEFVVLFVMLIPSRDYVYSIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTKCSSFSPPTTVILLILLCFEGLLFLIFTSVMFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASPFATPDQGKADPYQYVV
-
Molecular Weight
60.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZDHHC3, a member of the Zinc Finger DHHC-type Palmitoyltransferase (DHHC) family, plays a critical role in the post-translational modification of proteins through palmitoylation, which involves the addition of palmitic acid to cysteine residues. This modification is essential for regulating various cellular processes, including protein localization, stability, and interactions, thereby influencing crucial biological functions such as cell signaling, membrane dynamics, and neuronal development. Research has indicated that ZDHHC3 is involved in the palmitoylation of numerous proteins, including those implicated in neuronal differentiation and synaptic functions. Dysregulation of ZDHHC3 has been associated with various diseases, including neurodegenerative disorders and cancers, highlighting its potential as a therapeutic target. Additionally, the recombinant expression of ZDHHC3 offers an avenue to study its enzymatic activity, substrate specificity, and the molecular mechanisms underlying its role in cellular physiology. Understanding the functional implications of ZDHHC3 and its associated pathways could provide insights into the development of novel strategies for disease intervention, marking it as a significant focus in both fundamental and applied biomedical research.
