Analytical Data
-
Gene name
ZDHHC24
- Application
-
Alternative Names
Zinc finger DHHC domain-containing Protein 24
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UX98
-
Expression Region
1-284 aa
-
AA Sequence
MGQPWAAGSTDGAPAQLPLVLTALWAAAVGLELAYVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLRSDPSIRGVMLAGRGLGQGWAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFGNYRPFLCLLLHAAGVLLHVSVLLGPALSALLRAHTPLHMAALLLLPWLMLLTGRVSLAQFALAFVTDTCVAGALLCGAGLLFHGMLLLRGQTTWEWARGQHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTAS
-
Molecular Weight
56.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZDHHC24 is a member of the zinc finger DHHC-type containing protein family, which is known for its role in palmitoylation, a crucial post-translational modification that regulates protein localization, stability, and function. The study of ZDHHC24 has gained significance due to its implications in various cellular processes and associated diseases. Research indicates that ZDHHC24 is involved in the palmitoylation of several proteins, which in turn affects signaling pathways critical for cell growth, differentiation, and metabolism. Additionally, mutations or dysregulation of ZDHHC24 have been linked to neurodevelopmental disorders and cancers, emphasizing the need for a deeper understanding of its molecular mechanisms. Investigating the recombinant expression of ZDHHC24 not only aids in elucidating its functional roles but also provides potential therapeutic avenues for targeting palmitoylation-related pathways. Overall, the ongoing research into ZDHHC24 and its palmitoylation activity holds promise for advancing our knowledge of cellular communication and the development of novel treatments for diseases associated with its dysfunction.
