Analytical Data
-
Gene name
EIF3S12
- Application
-
Alternative Names
ARG134; eIF 3 p25; eIF 3 p28; eIF-3 p25; eIF-3 p28; EIF3-p28; eif3k; EIF3K_HUMAN; EIF3S12; Eukaryotic translation initiation factor 3 subunit 12; Eukaryotic translation initiation factor 3 subunit K; HSPC029; M9; MSTP001; Muscle specific gene M9 protein; Muscle-specific gene M9 protein; PLAC 24; PLAC-24; PLAC24; PRO1474; PTD001
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBQ5
-
Expression Region
2-218aa
-
AA Sequence
AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
-
Molecular Weight
51.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EIF3S4, or Eukaryotic Translation Initiation Factor 3 Subunit 4, is a crucial component of the eukaryotic translation initiation complex, playing a significant role in the initiation of protein synthesis. It is part of the larger eIF3 complex, which is essential for the binding of the ribosome to the mRNA and the subsequent recruitment of the initiator tRNA. The study of EIF3S4 is particularly important due to its implications in various biological processes, including cell proliferation, differentiation, and stress response. Additionally, research has indicated that dysregulation of EIF3S4 can be linked to several diseases, including cancer, making it a potential therapeutic target. Recent advancements in recombinant protein technology have allowed for the production and purification of EIF3S4 to study its structural and functional properties in more detail. Understanding the molecular mechanisms of EIF3S4 can provide insights into its role in translational regulation and its interaction with other components of the translation machinery. This knowledge could ultimately lead to novel interventions in diseases associated with protein synthesis dysregulation. Therefore, ongoing investigations into EIF3S4's structure-function relationship not only enhance our comprehension of fundamental cellular processes but also pave the way for the development of targeted therapeutics in diseases like cancer.
