Analytical Data
-
Gene name
ZCCHC3
- Application
-
Alternative Names
ZCCHC3; C20orf99; Zinc finger CCHC domain-containing Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NUD5
-
Expression Region
1-403 aa
-
AA Sequence
MATGGGAEEERKRGRPQLLPPARPAARGEEADGGREKMGWAQVVKNLAEKKGEFREPRPPRREEESGGGGGSAGLGGPAGLAAPDLGDFPPAGRGDPKGRRRDPAGEAVDPRKKKGAAEAGRRKKAEAAAAAMATPARPGEAEDAAERPLQDEPAAAAGPGKGRFLVRICFQGDEGACPTRDFVVGALILRSIGMDPSDIYAVIQIPGSREFDVSFRSAEKLALFLRVYEEKREQEDCWENFVVLGRSKSSLKTLFILFRNETVDVEDIVTWLKRHCDVLAVPVKVTDRFGIWTGEYKCEIELRQGEGGVRHLPGAFFLGAERGYSWYKGQPKTCFKCGSRTHMSGSCTQDRCFRCGEEGHLSPYCRKGIVCNLCGKRGHAFAQCPKAVHNSVAAQLTGVAGH
-
Molecular Weight
69.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZCCHC3 is a member of the zinc finger CCHC-type containing protein family, which plays a pivotal role in various biological processes, including RNA metabolism and cellular signal transduction. Recent research has implicated ZCCHC3 in the regulation of gene expression and its involvement in the antiviral response. Given the increasing prevalence of viral infections and the need for effective therapeutic strategies, understanding the molecular mechanisms of ZCCHC3 has become crucial. Studies have highlighted its function in promoting the stability and translation of specific mRNAs, as well as its interactions with viral proteins, which may facilitate viral replication or counteract host antiviral defenses. This dual role positions ZCCHC3 as a potential target for therapeutic intervention. Furthermore, dysregulation of ZCCHC3 has been associated with various diseases, including cancer, underscoring its significance in both health and disease. The ongoing exploration of ZCCHC3's structure and function through recombinant protein studies promises to elucidate its precise mechanisms of action, paving the way for novel approaches in drug development and therapeutic applications. As such, research on ZCCHC3 not only enhances our understanding of basic cellular processes but also holds the potential for impactful advancements in medical science.
