Analytical Data
-
Gene name
CAPZb
- Application
-
Alternative Names
CAPZb；F-actin-capping Protein subunit beta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P47756
-
Expression Region
1-272aa
-
AA Sequence
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC
-
Molecular Weight
57.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CAPZb (capping protein beta subunit) plays a crucial role in the regulation of actin dynamics, which is essential for various cellular processes, including motility, division, and signaling. Reconstituted as a heterodimer with its alpha counterpart, CAPZb binds to the barbed ends of actin filaments, preventing further polymerization and thereby stabilizing the actin cytoskeleton. Research on CAPZb has gained momentum due to its implications in various physiological and pathological conditions, including muscle contraction, cellular migration, and cancer metastasis. Understanding the structural and functional dynamics of CAPZb through recombinant protein studies can provide insights into its regulatory mechanisms and interaction with other actin-binding proteins. Advances in protein expression systems and purification techniques have enabled the generation of high-quality CAPZb recombinant proteins, facilitating in vitro assays and structural biology approaches like cryo-electron microscopy and X-ray crystallography. These studies are essential for decoding CAPZb's role in cellular mechanics, contributing to the broader understanding of actin filament organization and its impact on health and disease. The ongoing exploration of CAPZb could offer potential therapeutic avenues for targeting actin-related disorders, making it a significant focus for molecular and cellular biologists.
