Analytical Data
-
Gene name
ZBTB47
- Application
-
Alternative Names
ZBTB47; KIAA1190; ZNF651; Zinc finger and BTB domain-containing Protein 47; Zinc finger Protein 651
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UFB7
-
Expression Region
1-371 aa
-
AA Sequence
MATRSRENARRRGTPEPEEAGRRGGKRPKPPPGVASASARGPPATDGLGAKVKLEEKQHHPCQKCPRVFNNRWYLEKHMNVTHSRMQICDQCGKRFLLESELLLHRQTDCERNIQCVTCGKAFKKLWSLHEHNKIVHGYAEKKFSCEICEKKFYTMAHVRKHMVAHTKDMPFTCETCGKSFKRSMSLKVHSLQHSGEKPFRCENCNERFQYKYQLRSHMSIHIGHKQFMCQWCGKDFNMKQYFDEHMKTHTGEKPYICEICGKSFTSRPNMKRHRRTHTGEKPYPCDVCGQRFRFSNMLKAHKEKCFRVSHTLAGDGVPAAPGLPPTQPQAHALPLLPGLPQTLPPPPHLPPPPPLFPTTASPGGRMNANN
-
Molecular Weight
40.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZBTB47, also known as ZBTB7B, belongs to the ZBTB (Zinc Finger and BTB domain-containing protein) family, which plays critical roles in various biological processes, including gene regulation, cellular differentiation, and immune responses. Research has shown that ZBTB47 is involved in the regulation of immune-related genes and is crucial for the development and function of certain immune cells, such as T cells. Its expression is often linked to the modulation of inflammatory responses and has been implicated in various diseases, including autoimmune disorders and cancers. Due to its significant role in immune regulation, ZBTB47 has become a target of interest for therapeutic interventions aiming to enhance immune responses or to downregulate inappropriate inflammatory processes. The generation of recombinant ZBTB47 protein enables researchers to study its biochemical properties, examine its interactions with DNA and other proteins, and assess its potential as a drug target. By understanding the functional mechanisms of ZBTB47, researchers aim to uncover its contributions to health and disease, paving the way for novel treatments that could leverage its regulatory functions in the immune system.
