Analytical Data
-
Gene name
DUX2
- Application
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75505
-
Expression Region
1-80aa
-
AA Sequence
MALPKPSDGTLPAEVQGRGQRRRLVWTPSQSKALQACFERNPYPGITTRERLAQAIGIPEPRVQILFQNERSCQLRQHWH
-
Molecular Weight
8.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DUX2 is a gene known for its role in early embryonic development, particularly in the regulation of pluripotency and differentiation. Research has shown that DUX2 functions as a transcription factor, playing a critical role in the activation of specific gene sets that are essential for the formation of the trophectoderm, the outer cell layer of the blastocyst. Mutations and dysregulation of DUX2 have been implicated in various developmental disorders and conditions, making it a significant focus in the field of developmental biology and regenerative medicine. The study of DUX2 recombinant proteins has emerged as a crucial area of research, facilitating the investigation of its functional mechanisms and interactions with other cellular pathways. By producing and characterizing recombinant DUX2 proteins, researchers aim to elucidate the molecular underpinnings of its activity, paving the way for potential therapeutic applications in treating infertility and congenital disorders. Additionally, DUX2 has garnered attention for its potential links to cancer biology, highlighting the need for comprehensive studies on its biological roles. Overall, the exploration of DUX2 recombinant proteins holds promise for advancing our understanding of both normal developmental processes and pathological states associated with its dysfunction.
