Analytical Data
-
Gene name
TBRG1
- Application
-
Alternative Names
TBRG1; NIAM; Transforming growth factor beta regulator 1; Nuclear interactor of ARF and Mdm2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3YBR2
-
Expression Region
1-411 aa
-
AA Sequence
MSLLDGLASSPRAPLQSSKARMKKLPKKSQNEKYRLKYLRLRKAAKATVFENAAICDEIA RLEEKFLKAKEERRYLLKKLLQLQALTEGEVQAAAPSHSSSLPLTYGVASSVGTIQGAGP ISGPSTGAEEPFGKKTKKEKKEKGKENNKLEVLKKTCKKKKMAGGARKLVQPIALDPSGR PVFPIGLGGLTVYSLGEIITDRPGFHDESAIYPVGYCSTRIYASMKCPDQKCLYTCQIKD GGVQPQFEIVPEDDPQNAIVSSSADACHAELLRTISTTMGKLMPNLLPAGADFFGFSHPA IHNLIQSCPGARKCINYQWVKFDVCKPGDGQLPEGLPENDAAMSFEAFQRQIFDEDQNDP LLPGSLDLPELQPAAFVSSYQPMYLTHEPLVDTHLQHLKSPSQGSPIQSSD
-
Molecular Weight
44.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TBRG1, or TGF-beta receptor-regulated gene 1, is a critical protein involved in various cellular processes, including cell proliferation, differentiation, and apoptosis. Its role in oncogenesis has garnered significant interest, as TBRG1 is implicated in the regulation of tumor suppressor pathways and the modulation of responses to transforming growth factor-beta (TGF-β) signaling. Research has shown that TBRG1 can interact with multiple signaling pathways, affecting gene expression and cellular behavior in both normal and cancerous cells. The study of recombinant TBRG1 protein is essential for understanding its functional mechanisms and roles in various biological contexts. By employing techniques such as molecular cloning and protein expression systems, researchers can produce TBRG1 in its recombinant form to investigate its structure-function relationships, binding interactions, and potential as a therapeutic target. Furthermore, the study of TBRG1 offers insights into tumor microenvironment interactions and may reveal novel strategies for cancer treatment. As such, the exploration of TBRG1 and its recombinant protein is a growing area of interest within cancer biology and therapeutic development.
