Analytical Data
-
Gene name
DSCR5
- Application
-
Alternative Names
PIGP; DCRC; DSCR5; DSCRC; NPD010; Phosphatidylinositol N-acetylglucosaminyltransferase subunit P; Down syndrome critical region protein 5; Down syndrome critical region protein C
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P57054
-
Expression Region
1-134aa
-
AA Sequence
MVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFIPESWLNSLGLTYWPQKYWAVALPVYLLIAIVIGYVLLFGINMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN
-
Molecular Weight
40.37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of DSCR5 (Down Syndrome Critical Region 5) recombinant protein has gained significant attention due to its potential implications in understanding Down syndrome and related cellular processes. DSCR5 is located within the Down syndrome critical region on chromosome 21, which is believed to play a role in the manifestations of the syndrome, including cognitive impairments and developmental delays. Research has indicated that DSCR5 may be involved in various cellular mechanisms, including gene expression regulation, neuronal development, and response to stress. By recombinantly producing DSCR5 protein, researchers aim to investigate its biochemical properties, interactions with other proteins, and functional roles in cellular pathways. This foundational knowledge could provide insights into how overexpression of genes in the critical region contributes to the phenotype of Down syndrome. Furthermore, understanding the precise mechanisms of DSCR5 can pave the way for therapeutic approaches targeting the molecular pathways affected in Down syndrome, potentially leading to innovative treatments that ameliorate some of the cognitive and physical challenges faced by individuals with this condition. Thus, the exploration of DSCR5 recombinant protein represents a crucial step in bridging the gap between genetic factors and clinical outcomes in Down syndrome research.
