Analytical Data
-
Gene name
FOXC1
- Application
-
Alternative Names
FOXC1；FKHL7；FREAC3；Forkhead box Protein C1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q12948
-
Expression Region
1-553aa
-
AA Sequence
MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKDRLHLKEPPPPGRQPPPAPPEQADGNAPGPQPPPVRIQDIKTENGTCPSPPQPLSPAAALGSGSAAAVPKIESPDSSSSSLSSGSSPPGSLPSARPLSLDGADSAPPPPAPSAPPPHHSQGFSVDNIMTSLRGSPQSAAAELSSGLLASAAASSRAGIAPPLALGAYSPGQSSLYSSPCSQTSSAGSSGGGGGGAGAAGGAGGAGTYHCNLQAMSLYAAGERGGHLQGAPGGAGGSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF
-
Molecular Weight
62.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FOXC1 (Forkhead box C1) is a member of the forkhead box transcription factor family, playing a pivotal role in various biological processes, including embryogenesis, cell differentiation, and tissue repair. Recent studies have implicated FOXC1 in several diseases, particularly in cancer and cardiovascular conditions, highlighting its function in regulating cell proliferation, migration, and survival. Abnormal expression of FOXC1 has been associated with an aggressive tumor phenotype in various cancers, making it a potential biomarker for disease progression and a target for therapeutic interventions. Furthermore, FOXC1 is crucial in ocular development, with mutations linked to congenital glaucoma and other eye disorders. The recombinant expression of FOXC1 protein is essential for understanding its functional mechanisms and regulatory pathways, as well as for exploring its potential as a therapeutic target. Research involving FOXC1 recombination has advanced our knowledge of transcriptional regulation, signaling pathways, and the intricate network of gene interactions in both health and disease. By producing and characterizing FOXC1 recombinant protein, scientists aim to develop novel strategies for targeting its activity and investigating its role in pathophysiological contexts. Such efforts contribute significantly to the understanding of FOXC1’s role in development and disease, paving the way for future diagnostic and therapeutic applications.
