Analytical Data
-
Gene name
TAS2R16
- Application
-
Alternative Names
TAS2R16; Taste receptor type 2 member 16; T2R16
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NYV7
-
AA Sequence
MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQWASMLNNFCSYFNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRWRILRLFPWILLGSLMITCVTIIPSAIGNYIQIQLLTMEHLPRNSTVTDKLENFHQYQFQAHTVALVIPFILFLASTIFLMASLTKQIQHHSTGHCNPSMKARFTALRSLAVLFIVFTSYFLTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC
-
Molecular Weight
34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TAS2R16 is a member of the TAS2R family of taste receptors, which are G protein-coupled receptors (GPCRs) primarily responsible for detecting bitter compounds. Research into TAS2R16 is significant due to its potential role in sensing dietary toxins and its implications in nutrition and toxicology. TAS2R16 is expressed in the taste buds, where it contributes to the perception of bitter flavors, a response that is evolutionarily important for survival by helping organisms avoid harmful substances. Genetic variations in TAS2R16 have been linked to individual differences in taste perception and dietary preferences, which can influence health outcomes. Understanding the structure and function of this receptor through recombinant protein studies can provide insights into its activation mechanism and ligand specificity, thereby enhancing our knowledge of bitterness perception. Furthermore, TAS2R16's interactions with various biologically relevant compounds can pave the way for novel applications in food science, pharmacology, and understanding taste-related disorders. Overall, characterizing TAS2R16 as a recombinant protein is pivotal for both fundamental research and practical applications, enhancing our grasp of human taste perception and its evolutionary significance.
