Analytical Data
-
Gene name
DPCR1
- Application
-
Alternative Names
bCX105N19.6; Diffuse panbronchiolitis critical region 1; Diffuse panbronchiolitis critical region; Diffuse panbronchiolitis critical region protein 1; DKFZp666O235
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3MIW9
-
Expression Region
1-235aa
-
AA Sequence
MTQVTEKSTEHPEKTTSTTEKTTRTPEKPTLYSEKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKGIHAGQMGENDSFPAWAIVIVVLVAVILLLVFLGLIFLVSYMMRTRRTLTQNTQYNDAEDEGGPNSYPVYLMEQQNLGMGQIPSPR
-
Molecular Weight
52.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DPCR1 (Dipeptidyl Peptidase IV C-Terminally Extended Protein 1) is a newly identified member of the dipeptidyl peptidase IV (DPP IV) family, which plays a crucial role in diverse biological processes, including immune regulation, cell signaling, and metabolic control. The study of DPCR1 has gained interest due to its potential involvement in various diseases, such as cancer and diabetes, as it is believed to modulate the activity of several peptide hormones and growth factors through its proteolytic activity. Understanding the structure and function of DPCR1 is essential for uncovering its biological significance and therapeutic potential. Researchers aim to characterize the recombinant DPCR1 protein to elucidate its enzymatic properties, substrate specificity, and interaction with other proteins. This research may provide insights into the physiological roles of DPCR1 and its implications in pathological conditions, paving the way for novel therapeutic strategies targeting this protein in disease management.
