Analytical Data
-
Gene name
MyoD
- Application
-
Alternative Names
MyoD；BHLHC1；MYF3；MYOD；Myoblast determination Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15172
-
Expression Region
2-320aa
-
AA Sequence
29aa_Tag_ELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRF FEDLDPRLMHVGALLKPEEHSHFPAAVHPAPGAREDEHVRAPSGHHQAGR CLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQ RLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYAPGPLPPGRGGEH YSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCYEGAYYNEAPSEPRPGK SAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGE SSGDPTQSPDAAPQCPAGANPNPIYQVLLEESGGGGSPGRRRRRRRRRRR
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MyoD is a critical transcription factor in the regulation of myogenic differentiation, playing a pivotal role in the development and regeneration of skeletal muscle. Discovered in the late 1980s, MyoD belongs to a family of myogenic regulatory factors (MRFs) that initiate muscle lineage commitment and regulate the expression of muscle-specific genes. The significance of MyoD extends beyond muscle biology; it has been studied for its potential in therapeutic applications, such as muscle-wasting diseases and regenerative medicine. The recombinant protein form of MyoD has been utilized in various research settings to elucidate its mechanisms of action, interaction with other proteins, and role in cellular processes. Researchers have employed techniques such as gene editing and protein engineering to enhance MyoD’s functionality and stability, facilitating its application in muscle regeneration studies. Additionally, understanding the structural and functional properties of MyoD at the molecular level has implications for developing targeted therapies that can manipulate muscle regeneration pathways. The exploration of MyoD as a recombinant protein continues to provide insights into the complex network governing muscle development and offers promising avenues for future biomedical interventions.
