Cat: PA1000-8065

Recombinant Human FRS2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FRS2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FRS2;Fibroblast growth factor receptor substrate 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8WU20

  • Expression Region

    1-512aa

  • AA Sequence

    MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTR KRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNM LQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGY PRYPSFGDASSHPSSRHPSVGSARLPSVGEESTHPLLVAEEQVHTYVNTT GVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVK FVLGPTPVQKQLMEKEKLEQLGRDQVSGSGANNTEWDTGYDSDERRDAPS VNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYE NLPSLPPVWEARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTV PASAHKIEYSRRRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNP QTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALPRDDGTSRKTR HNSTDLPMLAWK

  • Molecular Weight

    83 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FRS2 (Fibroblast Growth Factor Receptor Substrate 2) is an intracellular adaptor protein that plays a crucial role in various signaling pathways, particularly those associated with fibroblast growth factor (FGF) receptors. It is involved in processes such as cell proliferation, differentiation, and survival, making it essential for normal development and tissue homeostasis. Dysregulation of FRS2 has been implicated in various diseases, including cancer, where it can contribute to tumor growth and metastasis. The study of FRS2 recombinant proteins has gained significant attention due to their potential applications in understanding these signaling pathways and developing targeted therapies. By using recombinant techniques to produce FRS2, researchers can investigate its structural properties, interaction with other signaling molecules, and downstream effects on cellular functions. This research not only enhances our understanding of FGF signaling mechanisms but also opens avenues for developing therapeutic strategies that could mitigate the effects of abnormal FRS2 activity in diseases. The insights gained from FRS2 studies can contribute to the broader field of signal transduction and cancer biology, ultimately aiding in the discovery of novel interventions for related pathologies. The ongoing exploration of FRS2 functions and its role in regulatory networks continues to be a promising area of research in cellular biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US