Analytical Data
-
Gene name
TACC3
- Application
-
Alternative Names
ERIC 1; ERIC-1; ERIC1; MGC117382; MGC133242; OTTHUMP00000113796; TACC3; TACC3_HUMAN; Transforming acidic coiled coil containing protein 3; Transforming acidic coiled-coil-containing protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6A5
-
Expression Region
1-100 aa
-
AA Sequence
MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQK
-
Molecular Weight
36.74kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The TACC3 protein, part of the transforming acidic coiled-coil (TACC) family, plays a crucial role in cell division and maintaining genomic stability. It is characterized by its involvement in organizing the mitotic spindle, ensuring proper chromosome alignment during mitosis. Dysregulation or overexpression of TACC3 has been linked to various cancers, making it a potential biomarker for tumor progression and a target for therapeutic intervention. Recent studies have revealed that TACC3 interacts with numerous cellular pathways, including those regulating microtubule dynamics and centrosome function. As a result, understanding the precise mechanisms of TACC3 function and its contributions to oncogenesis has become a significant focus of cancer research. By investigating TACC3's structural properties and its interactions at the molecular level, researchers aim to uncover novel strategies for cancer treatment while enhancing our fundamental understanding of cell cycle regulation. Through these studies, TACC3 not only emerges as a vital player in mitotic processes but also as a promising target in the quest for innovative cancer therapies.
