Cat: PA1000-8051

Recombinant Human IL32 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL32

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL32;NK4;TAIF;Interleukin-32

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P24001-4

  • Expression Region

    1-131aa

  • AA Sequence

    MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDF KEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEP GESFCDKSYGAPRGDKEELTPQKCSEPQSSK

  • Molecular Weight

    15 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IL-32, or Interleukin-32, is a pro-inflammatory cytokine that plays a significant role in the immune response and has been implicated in various inflammatory diseases, including rheumatoid arthritis, tuberculosis, and certain cancers. Identified in 2005, IL-32 is expressed by multiple immune cells and can influence the production of other cytokines, thereby orchestrating inflammatory processes. Its discovery sparked interest in understanding its mechanisms of action and potential therapeutic applications. Researchers have focused on recombinant IL-32 protein production to investigate its biological functions and interactions with immune cells. The recombinant form allows for detailed studies of its structural properties and the elucidation of its role in immune modulation. Recent studies have shown that IL-32 can not only enhance the inflammatory response but also promote apoptosis in certain cancer cell lines, positioning it as a dual-function cytokine. These findings underscore the need for further research into IL-32's potential as a biomarker for disease progression and as a target for novel therapies. Understanding the nuances of IL-32's action could lead to innovative treatments for inflammatory disorders and improved patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US