Analytical Data
-
Gene name
SUHW4
- Application
-
Alternative Names
MGC21637; MGC61687; SUHW4; Suppressor of hairy wing homolog 4 (Drosophila); Suppressor of hairy wing homolog 4; Z280D_HUMAN; Zinc finger protein 280D; Zinc finger protein 634; Znf280d; ZNF634
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6N043
-
Expression Region
1-158 aa
-
AA Sequence
MGDNPFQPKSNSKMAELFMECEEEELEPWQKKVKEVEDDDDDEPIFVGEISSSKPAISNILNRVNPSSYSRGLKNGALSRGITAAFKPTSQHYTNPTSNPVPASPINFHPESRSSDSSVIVQPFSKPVSVSKTIRPAQGSIGCCLSISTVPSYNSGLS
-
Molecular Weight
43.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SUHW4 is a recombinantly expressed protein that has garnered significant interest in the field of molecular biology and biotechnology due to its potential applications in various areas, including therapeutics and industrial processes. The study of SUHW4 is particularly important because it plays a crucial role in specific biological pathways, influencing cellular functions and responses. Research has shown that SUHW4 possesses unique structural and functional properties that can be tailored for various purposes, making it a valuable candidate for drug development and biomanufacturing. Moreover, understanding the mechanisms underlying SUHW4's activity can provide insights into disease mechanisms, particularly in conditions where this protein is dysregulated. Ongoing studies are exploring its interactions with other biomolecules and its role in metabolic pathways, aiming to elucidate its function and therapeutic potential. This understanding could lead to novel strategies for disease intervention, especially in areas where traditional treatments are limited. As researchers continue to unravel the complexities of SUHW4, its applications could expand, paving the way for innovative solutions in medicine and biotechnology. Consequently, the research on SUHW4 not only contributes to basic biological knowledge but also holds promise for practical applications that could benefit society at large.
