Analytical Data
-
Gene name
DNAJC7
- Application
-
Alternative Names
DJ11; DJC7; DnaJ (Hsp40) homolog subfamily C member 7; DnaJ homolog subfamily C member 7; Dnajc7; DNJC7_HUMAN; Tetratricopeptide repeat domain 2; Tetratricopeptide repeat protein 2; TPR repeat protein 2; TPR2; TTC2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99615
-
Expression Region
1-484aa
-
AA Sequence
MAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG
-
Molecular Weight
78.98 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DNAJC7, a member of the DnaJ homolog protein family, plays a crucial role in protein folding and management within the cellular environment. Research has shown that DNAJC7 is involved in various cellular processes, including the stress response and protein quality control, primarily through its interaction with heat shock proteins. Its unique structure, characterized by a J-domain, enables it to facilitate the proper folding of nascent polypeptides and the refolding of misfolded proteins. Recent studies have highlighted the significance of DNAJC7 in neurodegenerative diseases, where misfolded proteins accumulate, leading to cellular dysfunction. Its potential as a therapeutic target is underscored by its involvement in pathways related to protein aggregation and cellular stress. Understanding the functional mechanisms of DNAJC7 through the production of recombinant protein can provide valuable insights into its role in cellular homeostasis and disease pathogenesis. Consequently, the research on DNAJC7 recombinant proteins is not only central to deciphering its biological functions but also pivotal in developing therapeutic strategies for conditions associated with protein misfolding, thus opening new avenues in molecular biology and medicine.
