Analytical Data
-
Gene name
a2M
- Application
-
Alternative Names
a2M；AP-1 complex subunit mu-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01023
-
Expression Region
641-730aa
-
AA Sequence
DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCP QLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
α2-macroglobulin (A2M) is a large plasma glycoprotein that plays a crucial role in regulating protease activity and modulating inflammatory responses. Originally identified for its ability to inhibit a wide range of proteases by undergoing a unique conformational change upon enzyme binding, A2M also acts as a carrier for various growth factors and cytokines, influencing cellular processes and tissue regeneration. Research into A2M has gained momentum due to its potential implications in several pathophysiological conditions, including neurodegenerative diseases, cancer, and chronic inflammation. A2M’s involvement in neuronal protection and its ability to sequester harmful proteases has sparked interest in its therapeutic potential for conditions such as Alzheimer’s disease and multiple sclerosis. Additionally, studies have highlighted the role of A2M in modulating the immune response, making it a candidate for therapeutic interventions in autoimmune disorders. The recent advancements in recombinant protein technology have facilitated the production of biologically active A2M, enabling detailed studies on its structure-function relationships and therapeutic applications. Researchers are exploring A2M's ability to enhance wound healing, reduce scarring, and promote tissue repair, positioning it as a promising biomolecule in regenerative medicine. Overall, the multifaceted role of A2M in health and disease continues to drive intense investigation, paving the way for novel therapeutic strategies that harness its protective properties against a variety of diseases.
