Cat: PA1000-7953

Recombinant Human TLR5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TLR5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TLR5;TIL3;Toll-like receptor 5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O60602

  • Expression Region

    517-634aa

  • AA Sequence

    LPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPD VFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSF SGVSLFSLSTEGCDEEEV

  • Molecular Weight

    39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TLR5 (Toll-like receptor 5) is a key component of the innate immune system, primarily recognized for its role in detecting bacterial flagellin, a crucial structural protein of bacterial flagella. The activation of TLR5 leads to the initiation of immune responses, thereby playing a pivotal role in the body's defense against bacterial infections. Recent studies have highlighted the significance of TLR5 not only in pathogen recognition but also in modulating inflammatory responses and influencing adaptive immunity. The recombinant protein form of TLR5 has garnered interest for its potential applications in vaccine development, as it can enhance the immune response when used as an adjuvant. Researchers are exploring the structural and functional characteristics of TLR5 recombinant proteins to better understand their mechanisms of action, optimize their immunogenicity, and evaluate their efficacy in therapeutic contexts. Moreover, the recombinant TLR5 protein is being investigated for its ability to stimulate potency against various pathogens, thereby presenting promising avenues for clinical applications in infectious diseases and immunotherapy. Understanding the functional dynamics of TLR5 through recombinant technology not only elucidates fundamental immunological processes but also opens doors for innovative strategies in disease prevention and treatment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US