Cat: PA1000-7926

Recombinant Human Smad6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Smad6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Smad6;MADH6;Mothers against decapentaplegic homolog 6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43541

  • Expression Region

    1-496aa

  • AA Sequence

    MFRSKRSGLVRRLWRSRVVPDREEGGSGGGGGGDEDGSLGSRAEPAPRAR EGGGCGRSEVRPVAPRRPRDAVGQRGAQGAGRRRRAGGPPRPMSEPGAGA GSSLLDVAEPGGPGWLPESDCETVTCCLFSERDAAGAPRDASDPLAGAAL EPAGGGRSREARSRLLLLEQELKTVTYSLLKRLKERSLDTLLEAVESRGG VPGGCVLVPRADLRLGGQPAPPQLLLGRLFRWPDLQHAVELKPLCGCHSF AAAADGPTVCCNPYHFSRLCGPESPPPPYSRLSPRDEYKPLDLSDSTLSY TETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVY DQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGV WAYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGLQHAP EPDAADGPYDPNSVRISFAKGWGPCYSRQFITSCPCWLEILLNNPR

  • Molecular Weight

    53 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Smad6 is a member of the Smad family of proteins that play a crucial role in the Transforming Growth Factor-beta (TGF-β) signaling pathway, which is important for various cellular processes such as proliferation, differentiation, and apoptosis. Smad6 is primarily known as an inhibitor of this pathway, functioning to modulate the effects of TGF-β signaling by interacting with receptor-activated Smads and preventing their nuclear translocation. The study of recombinant Smad6 protein has gained significant interest due to its potential applications in understanding cellular mechanisms that underlie various diseases, including fibrosis, cancer, and cardiovascular disorders. By producing recombinant Smad6, researchers aim to elucidate its structure-function relationship, explore its interactions with other molecular players in the TGF-β signaling cascade, and identify potential therapeutic strategies to target the pathway in disease contexts. Furthermore, investigating Smad6's role in regulating gene expression can provide insights into how cellular responses to TGF-β are fine-tuned. Overall, research on recombinant Smad6 protein not only enhances our understanding of TGF-β signaling dynamics but also opens avenues for the development of novel therapeutic interventions to modulate this important signaling pathway in various pathological conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US