Cat: PA1000-7915

Recombinant Human SESN2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SESN2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SESN2;Hi95;SEST2;Sestrin-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P58004

  • Expression Region

    2-480aa

  • AA Sequence

    IVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVE EVLREGAESLEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLL HTDGPLASSWRHYIAIMAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLHR APEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLL THCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGG FESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSA DILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSL IQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVF GIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSE KVHVNLLLLEARMQAALLYALRAITRYMT

  • Molecular Weight

    55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SESN2, or Sestrin 2, is a highly conserved stress-responsive protein that plays a critical role in cellular stress responses, including oxidative stress and nutrient deprivation. It is part of the Sestrin family, which is known to modulate cellular metabolism, promote longevity, and protect against age-related diseases. Research has shown that SESN2 exerts its protective effects through several mechanisms, including the activation of autophagy, inhibition of the mTOR pathway, and modulation of antioxidant responses. Dysregulation of SESN2 has been implicated in various pathophysiological conditions, such as cancer, neurodegenerative diseases, and metabolic disorders. Consequently, SESN2 has garnered significant attention as a potential therapeutic target. Studies involving the recombinant expression and purification of SESN2 have facilitated the exploration of its biochemical properties and functional roles in cellular homeostasis. Investigating SESN2's mechanistic pathways and interactions not only enhances our understanding of its protective functions but also offers insights into potential interventions to manipulate its expression or activity in disease contexts. Given the growing interest in the role of cellular stress responses in health and disease, SESN2 and its recombinant protein form serve as promising candidates for advancing therapeutic strategies aimed at combating stress-induced cellular damage and promoting cellular resilience.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US