Analytical Data
-
Gene name
SQRDL
- Application
-
Alternative Names
Sulfide:quinone oxidoreductase. mitochondrial. SQOR. EC:1.8.5.8. Sulfide dehydrogenase-like. Sulfide quinone oxidoreductase
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6N5
-
Expression Region
1-450 aa
-
AA Sequence
MVPLVAVVSGPRAQLFACLLRLGTQQVGPLQLHTGASHAARNHYEVLVLGGGSGGITMAARMKRKVGAENVAIVEPSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKARVTELNPDKNCIHTDDDEKISYRYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDKPGETQVISYEMLHVTPPMSPPDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKADLMPFLYWNMMLRGYWGGPAFLRKLFHLGMS
-
Molecular Weight
76.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SQRDL, or Sulfide Quinone Reductase-Like protein, is a fascinating protein that has drawn attention in the field of biochemistry and molecular biology due to its potential role in various metabolic and bioenergetic processes. Research indicates that SQRDL is involved in cellular responses to oxidative stress and plays a part in the regulation of sulfide metabolism, which is crucial for maintaining cellular homeostasis and function. The protein's unique structure suggests that it may participate in redox reactions, facilitating the conversion of sulfide to less toxic forms, thereby protecting cells from harmful effects associated with sulfide accumulation. Its presence across different species hints at an evolutionary conserved function, further underscoring its biological significance. As scientists continue to investigate the intricate mechanisms of SQRDL, understanding its role could have implications for developing therapeutic strategies for diseases linked to oxidative stress and sulfide dysregulation. The ongoing research aims to elucidate the protein's structure-function relationship, its interactions with other cellular components, and its overall contribution to metabolic pathways, paving the way for novel insights into cellular redox balance and energy metabolism.
