Analytical Data
-
Gene name
ASH2L
- Application
-
Alternative Names
ASH2L；ASH2L1；Set1/Ash2 histone methyltransferase complex subunit ASH2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBL3
-
Expression Region
1-534aa
-
AA Sequence
MDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP
-
Molecular Weight
76.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ASH2L (Absent, Small, or Homeotic 2-like) is a crucial protein involved in the regulation of gene expression, specifically functioning as a component of the ASH2L-MLL (Mixed-lineage leukemia) complex. The MLL complex plays a significant role in histone methylation, particularly in the methylation of histone H3 at lysine 4 (H3K4), which is a mark associated with active transcription. Dysregulation of ASH2L or the MLL complex has been implicated in various cancers, including leukemia, as it can lead to improper gene expression patterns that promote tumorigenesis. Research has focused on the structure and function of ASH2L to understand its role in chromatin remodeling and transcriptional control. Additionally, studies have explored its protein-protein interactions, post-translational modifications, and the mechanisms by which it contributes to maintaining stem cell properties and lineage differentiation. Understanding ASH2L's function not only provides insights into fundamental biological processes but also presents potential therapeutic avenues for targeting its dysregulation in cancer. The study of ASH2L recombinant proteins allows researchers to dissect its functions systematically and evaluate how alterations in its activity can impact cellular behavior, paving the way for innovative cancer treatments aimed at correcting pathway dysregulations associated with ASH2L.
