Analytical Data
-
Gene name
DHRS13
- Application
-
Alternative Names
DHRS13; SDR7C5; UNQ419/PRO853Dehydrogenase/reductase SDR family member 13; EC 1.1.-.-; Short chain dehydrogenase/reductase family 7C member 5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UX07
-
Expression Region
1-327aa
-
AA Sequence
MTALELARRGARVVLACRSQERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLSSEPRLDILIHNAGISSCGRTREAFNLLLRVNHIGPFLLTHLLLPCLKACAPSRVVVVASAAHCRGRLDFKRLDRPVVGWRQELRAYADTKLANVLFARELANQLEATGVTCYAAHPGPVNSELFLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHRLWEASKRLAGLGPGEDAEPDEDPQSEDSEAPSSLSTPHPEEPTVSQPYPSPQSSPDLSKMTHRIQAKVEPEIQLS
-
Molecular Weight
62.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DHRS13 (Dehydrogenase/Reductase 13) is a member of the short-chain dehydrogenase/reductase (SDR) family, which plays a critical role in various metabolic processes, including steroid metabolism and cellular signaling pathways. The enzyme is characterized by its ability to catalyze the reduction and oxidation of a wide range of substrates, contributing to the regulation of intracellular levels of key metabolites. Recent studies have suggested that DHRS13 may be involved in the metabolites' metabolism and the modulation of oxidative stress, which are vital in various physiological and pathological conditions, including cancer and metabolic disorders. Furthermore, the expression of DHRS13 is regulated by various signaling pathways, highlighting its potential role as an indicator of cellular stress responses. Understanding the structure-function relationships of DHRS13 and its enzymatic activity may provide insights into its biological significance. This has spurred research into elucidating its substrate specificity, reaction mechanisms, and regulatory mechanisms. As DHRS13 emerges as a potential therapeutic target, elucidating its role in human health and disease continues to be a focal point of biochemistry and molecular biology research. Investigating DHRS13’s involvement in metabolic networks could lead to novel strategies for drug development and therapeutic interventions, particularly for diseases characterized by dysregulated metabolic pathways. Thus, understanding the function and regulation of DHRS13 is critical for elucidating its role in metabolism and its potential implications in health and disease management.
