Analytical Data
-
Gene name
KMP-11
- Application
-
Alternative Names
KMP-11；KMP-11/2；KMP-11/3；KMP-11/4；Kinetoplastid membrane Protein 11
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9U6Z1
-
Expression Region
1-92aa
-
AA Sequence
MATTLEEFSAKLDRLDAEFAKKMEEQNKKFFADKPDESTLSPEMKEHYEKFEKMIQEHTDKFNKKMHEHSEHFKAKFAELLEQQKNAQFPGK
-
Molecular Weight
18.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KMP-11, a recombinant protein derived from the Kinetoplastida family of parasites, has garnered significant attention in parasitology and immunology research due to its potential role in vaccine development and therapeutic interventions. This protein is primarily associated with the life cycle of Leishmania spp., which are responsible for leishmaniasis, a disease affecting millions worldwide. The complexity of the Leishmania lifecycle and its ability to evade host immune responses complicate vaccine formulation and treatment strategies. KMP-11 is known for its immunogenic properties, eliciting strong immune responses in infected hosts, which positions it as a candidate for inclusion in multi-epitope vaccines. Additionally, its expression profile during various stages of the parasite life cycle suggests that it might play a critical role in parasite survival and pathogenicity. Researchers have been focusing on elucidating the molecular mechanisms underlying KMP-11’s function and its interactions with the host immune system. By using recombinant DNA technology, scientists aim to produce this protein in a controlled manner, enabling detailed studies on its structure, function, and immunogenic potential. Understanding KMP-11’s role could facilitate the development of effective diagnostic tools and immunotherapeutics, ultimately contributing to the broader fight against leishmaniasis. The ongoing investigations into KMP-11 epitomize the intersection of basic research and applied science in addressing pressing public health challenges posed by neglected tropical diseases.
