Analytical Data
-
Gene name
DERL3
- Application
-
Alternative Names
DERL3; C22orf14; DER3; LLN2; Derlin-3; Degradation in endoplasmic reticulum protein 3; DERtrin-3; Der1-like protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96Q80
-
Expression Region
1-205aa
-
AA Sequence
MAWQGLAAEFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTNFLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFLGQALMAMLVYVWSRRSPRVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDVFPNQPGGKRLLQTPGFL
-
Molecular Weight
49.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DERL3, a member of the Derlin family, plays a crucial role in the endoplasmic reticulum (ER) quality control system, particularly in the degradation of misfolded proteins through ER-associated degradation (ERAD). As a membrane protein, DERL3 is involved in recognizing and extracting these faulty proteins from the ER and facilitating their transport to the proteasome for degradation. The significance of DERL3 is underscored by its implication in various diseases, including neurodegenerative disorders and certain cancers, where the accumulation of misfolded proteins can lead to cellular stress and dysfunction. Recent studies have highlighted the importance of DERL3 in mediating the degradation of specific client proteins, making it a potential therapeutic target. Understanding the mechanisms underlying DERL3's function and its interactions with other ERAD components can provide valuable insights into maintaining cellular homeostasis and developing strategies to combat diseases associated with protein misfolding. Consequently, research on DERL3 recombinant proteins has gained momentum, aiming to elucidate its structural properties and functional dynamics, ultimately paving the way for innovative approaches in treating diseases linked to ER stress and impaired protein quality control.
