Analytical Data
-
Gene name
DERL1
- Application
-
Alternative Names
DERL1; DER1; UNQ243/PRO276; Derlin-1; Degradation in endoplasmic reticulum protein 1; DERtrin-1; Der1-like protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BUN8
-
Expression Region
1-251aa
-
AA Sequence
MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATFYFPVGPGTGFLYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ
-
Molecular Weight
55.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DERL1 (Degradation of ER Luminal Protein 1) is a protein that plays a crucial role in the endoplasmic reticulum (ER) associated degradation (ERAD) pathway, which is essential for maintaining cellular homeostasis by regulating protein quality control. This pathway facilitates the recognition and disposal of misfolded or unassembled proteins from the ER, preventing the accumulation of potentially toxic aggregates. Research into DERL1 has gained momentum due to its implications in various diseases, particularly those related to protein misfolding disorders, such as Alzheimer’s disease and certain types of cancer. Understanding the molecular mechanisms by which DERL1 interacts with substrates and other components of the ERAD machinery could provide insights into therapeutic strategies to enhance protein quality control or to alleviate conditions caused by ER stress. Furthermore, the study of DERL1's role in immune responses and its potential involvement in viral infections have positioned it as a target for further investigation. The recombinant expression of DERL1 enables researchers to explore its functional properties, protein interactions, and structural characteristics, paving the way for advances in both basic biology and clinical applications. As research progresses, DERL1 is becoming an important focus within the fields of molecular biology and biomedicine, highlighting its significance in maintaining ER integrity and cellular health.











