Analytical Data
-
Gene name
GNb2
- Application
-
Alternative Names
GNb2；Guanine nucleotide-binding Protein G(I)/G(S)/G(T) subunit beta-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P62879
-
Expression Region
21-327aa
-
AA Sequence
ARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAV
-
Molecular Weight
60.4kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The GNb2 recombinant protein has gained attention in the field of biomedical research due to its potential therapeutic applications, particularly in the context of autoimmune diseases and cancer immunotherapy. GNb2, a fully human monoclonal antibody, targets the CD4 receptor, which plays a crucial role in T-cell activation and immune response modulation. Research has demonstrated that GNb2 can selectively inhibit T-helper cell activation, thereby reducing inflammation and autoimmunity. This makes it a promising candidate for treating conditions such as multiple sclerosis (MS) and other inflammatory diseases. Additionally, studies have indicated that GNb2 may enhance anti-tumor immunity by modulating the tumor microenvironment. The unique mechanism of action of GNb2, combined with its specificity and reduced immunogenicity, positions it as a novel therapeutic agent that could offer alternatives to existing treatments with fewer side effects. As ongoing clinical trials and preclinical studies explore its efficacy and safety, GNb2 represents a significant advancement in the development of targeted therapies that harness the immune system's capabilities while minimizing collateral damage to healthy tissues. This research underscores the importance of personalized medicine and the need for innovative approaches to tackle complex immune-related disorders.
