Analytical Data
-
Gene name
DEFB4B
- Application
-
Alternative Names
BD 2; BD-2; BD2; beta 2; beta 2 Defensin; Beta defensin 2; Beta defensin 4B; Beta-defensin 2; Beta-defensin 4A; DEF B2; DEF B4; DEFB 102; DEFB 2; DEFB 4; DEFB102; DEFB2; DEFB2; formerly; DEFB4; DEFB4; formerly; DEFB4B; DEFB4P; Defensin; Defensin beta 2; Defensin; beta 4; Defensin; beta 4; pseudogene; Defensin; beta 4A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15263
-
Expression Region
1-64aa
-
AA Sequence
MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKC CKKP
-
Molecular Weight
31.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Defensin beta 4B (DEFB4B) is a member of the defensin family, which comprises small, cationic peptides known for their antimicrobial properties. These peptides play a crucial role in the innate immune system, offering protection against a broad range of pathogens, including bacteria, fungi, and viruses. Research into DEFB4B has gained momentum due to its significant antibacterial activity and potential clinical applications in combating drug-resistant infections. The gene encoding DEFB4B is expressed predominantly in epithelial tissues, particularly in the skin and respiratory tract, suggesting its role in frontline defense against microbial invasion. In addition to its antimicrobial functions, DEFB4B has been implicated in modulating immune responses and promoting wound healing, further underscoring its biological importance. Investigating the structure-function relationship of DEFB4B and producing recombinant proteins for laboratory studies can enhance our understanding of its mechanisms of action. Such advancements may lead to the development of novel therapeutic agents derived from DEFB4B, providing new strategies for treating infections and inflammatory disorders. Given the rising incidence of antimicrobial resistance, DEFB4B represents a promising candidate for further research aimed at harnessing its protective properties for therapeutic applications.
