Analytical Data
-
Gene name
GPRC5A
- Application
-
Alternative Names
GPRC5A；GPCR5A；RAI3；RAIG1；Retinoic acid-induced Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NFJ5
-
Expression Region
269-357aa
-
AA Sequence
TKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
-
Molecular Weight
37.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPRC5A, a member of the G protein-coupled receptor (GPCR) family, has garnered significant attention in recent years due to its potential roles in various physiological and pathological processes. Initially identified as a receptor associated with cancer, GPRC5A is involved in regulating cell proliferation, differentiation, and apoptosis, linking it to tumorigenesis in multiple cancers, including lung and breast cancer. Its expression levels are often altered in cancerous tissues, suggesting its role as a potential biomarker and therapeutic target. Additionally, GPRC5A’s function extends beyond oncology; it is also implicated in neurological and metabolic disorders, highlighting its versatile biological functions. The generation of recombinant GPRC5A protein has facilitated detailed studies into its structure, signaling pathways, and interactions with other cellular components, thereby enhancing our understanding of its mechanisms of action. Researchers are particularly interested in its role in G protein signaling and its interactions with β-arrestins, which are crucial for modulating receptor activity and downstream effects. The study of GPRC5A not only provides insights into its contribution to disease mechanisms but also opens avenues for the development of novel therapeutic strategies targeting this receptor. Ultimately, the exploration of GPRC5A as a recombinantly expressed protein aims to unravel its complexities and foster the translation of these findings into clinical applications, addressing an urgent need for innovative cancer treatments and improved management of related disorders.
