Cat: PA1000-7845

Recombinant Human GRK4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GRK4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GRK4;GPRK2L;GPRK4;G Protein-coupled receptor kinase 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P32298

  • Expression Region

    140-578aa

  • AA Sequence

    KAFEECTRVAHNYLRGEPFEEYQESSYFSQFLQWKWLERQPVTKNTFRHY RVLGKGGFGEVCACQVRATGKMYACKKLQKKRIKKRKGEAMALNEKRILE KVQSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAV FYAAELCCGLEDLQRERIVYRDLKPENILLDDRGHIRISDLGLATEIPEG QRVRGRVGTVGYMAPEVVNNEKYTFSPDWWGLGCLIYEMIQGHSPFKKYK EKVKWEEVDQRIKNDTEEYSEKFSEDAKSICRMLLTKNPSKRLGCRGEGA AGVKQHPVFKDINFRRLEANMLEPPFCPDPHAVYCKDVLDIEQFSVVKGI YLDTADEDFYARFATGCVSIPWQNEMIESGCFKDINKSESEEALPLDLDK NIHTPVSRPNRGFFYRLFRRGGCLTMVPSEKEVEPKQC

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GRK4 (G-protein coupled receptor kinase 4) is a key enzyme that plays a critical role in regulating G-protein coupled receptor (GPCR) signaling, which is essential for various physiological processes. Dysregulation of GRK4 has been implicated in several cardiovascular and renal diseases, including hypertension and heart failure. Research into GRK4 has revealed that genetic polymorphisms in the GRK4 gene can affect its activity and expression, contributing to individual differences in disease susceptibility and drug response. The recombinant expression of GRK4 protein in suitable expression systems allows for in-depth studies on its structure, function, and regulatory mechanisms. By utilizing methods such as bacterial or eukaryotic expression systems, researchers can produce large quantities of GRK4 for biochemical, biophysical, and structural analyses. Understanding the molecular dynamics of GRK4 can provide insights into its role in GPCR desensitization and internalization, paving the way for the development of targeted therapies that can modulate its activity. Given the increasing recognition of GRK4 as a potential therapeutic target, ongoing research aims to delineate its precise functions and interactions, ultimately contributing to novel strategies for treating diseases associated with GPCR dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US