Analytical Data
-
Gene name
DEFB136
- Application
-
Alternative Names
beta 136; Beta-defensin 136; DB136_HUMAN; DEFB136; Defensin
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q30KP8
-
Expression Region
1-77aa
-
AA Sequence
MATRSVLLALVVLNLLFYVPPGRSGPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDTIHLCCVNPKYLPILTGK
-
Molecular Weight
35.42 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DEFB136 is a member of the beta-defensin family, which comprises small, cationic peptides known for their antimicrobial properties and role in the immune response. Research into DEFB136 has gained interest due to its potential involvement in innate immunity, particularly concerning host defense against various pathogens. The protein is predominantly expressed in epithelial tissues, suggesting a critical function in frontline defense mechanisms. Furthermore, studies have indicated that DEFB136 may play a role in modulation of the inflammatory response, which is vital for maintaining homeostasis during infections or tissue injury. Genetic analyzes have also shown variations in the DEFB136 gene that could impact susceptibility to infections and inflammatory diseases. Therefore, understanding the structure, function, and regulation of DEFB136 is vital not only for elucidating its role in the immune system but also for potential therapeutic applications, such as designing new antimicrobial agents or understanding autoimmune disorders. Advances in recombinant protein technology have facilitated the production and study of DEFB136, paving the way for further investigations into its functional properties and clinical significance. Harnessing the unique features of DEFB136 may provide new insights into therapeutic strategies that leverage innate immunity.
