Analytical Data
-
Gene name
PDCD2L
- Application
-
Alternative Names
PDCD2L；Integrin beta-1-binding Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BRP1
-
Expression Region
1-358aa
-
AA Sequence
AAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSPFHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSLLRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQILRYSWSGEPLFLTCPTSEVTELPACSQCGGQRIFEFQLMPALVSMLKSANLGLSVEFGTILVYTCEKSCWPPNHQTPMEEFCIIQEDPDELLFK
-
Molecular Weight
66.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PDCD2L (Programmed Cell Death 2-Like) is a member of the PDCD2 protein family, which plays a significant role in regulating apoptosis and cellular stress responses. This family of proteins is crucial for maintaining cellular homeostasis and has been implicated in various biological processes, including cell proliferation, differentiation, and immune responses. Research on PDCD2L has gained attention due to its potential involvement in the pathogenesis of several diseases, such as cancer and autoimmune disorders. Understanding the molecular mechanisms of PDCD2L can provide insights into its functional roles in these diseases. Recombinant PDCD2L protein is essential for elucidating its structure-function relationships and interactions with other biomolecules. Additionally, it serves as a valuable tool for studying the pathways regulated by PDCD2L. The production of recombinant PDCD2L allows for the investigation of its effects on cell survival and death under various stress conditions, contributing to our understanding of tumor biology and therapeutic responses. Overall, the study of recombinant PDCD2L protein is pivotal in informing new strategies for disease intervention and developing potential therapeutic applications.
