Analytical Data
-
Gene name
DDX39
- Application
-
Alternative Names
DDX39A; DDX39; ATP-dependent RNA helicase DDX39A; EC 3.6.4.13; DEAD box protein 39; Nuclear RNA helicase URH49
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00148
-
Expression Region
1-427aa
-
AA Sequence
MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQVIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMAQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNVAELPEEIDISTYIEQSR
-
Molecular Weight
75.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DDX39, a member of the DEAD-box RNA helicase family, plays a crucial role in various cellular processes, including RNA metabolism, ribosome biogenesis, and gene expression regulation. As a critical component of the spliceosome, DDX39 is involved in pre-mRNA splicing, contributing to the removal of introns and the joining of exons, thereby influencing mRNA maturation and stability. Dysregulation of DDX39 has been linked to various cancers and genetic disorders, highlighting its potential as a therapeutic target. The study of recombinant DDX39 protein enables researchers to investigate its biochemical properties, structural characteristics, and functional mechanisms in detail. By producing this protein in a controlled environment, scientists can perform biochemical assays, structural analyses, and interaction studies, providing insights into its role in cellular processes and disease mechanisms. Furthermore, understanding the specific functions and regulation of DDX39 could pave the way for the development of novel therapeutic strategies aimed at modulating its activity in pathological conditions. Overall, the study of DDX39 recombinant protein is vital for elucidating its biological significance and exploring its potential in biomedical research and therapeutic applications.
