Analytical Data
-
Gene name
MTX1
- Application
-
Alternative Names
MTX1；MTX；MTXN；Metaxin-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13505
-
Expression Region
170-295aa
-
AA Sequence
LDSLAVLTYARFTGAPLKVHKISNPWQSPSGTLPALRTSHGEVISVPHKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLVHTFWIDTKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQ
-
Molecular Weight
15.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MTX1 (Methotrexate Resistance Protein 1) is a member of the ATP-binding cassette (ABC) transporter family and has garnered attention for its role in drug resistance, particularly in cancer therapy. Research has shown that MTX1 can contribute to the efflux of chemotherapeutic agents, thereby reducing their efficacy and facilitating tumor growth. Understanding the molecular mechanisms underlying MTX1 expression and function is crucial for improving therapeutic strategies against resistant tumors. Recent studies have focused on characterizing the MTX1 recombinant protein to elucidate its structural and functional properties. This includes examining its binding affinities, transport capabilities, and interactions with various substrates. By producing and analyzing MTX1 recombinant proteins in controlled laboratory settings, researchers aim to develop inhibitors that can effectively block its activity, potentially overcoming drug resistance in cancer treatments. Additionally, insights gained from MTX1 studies may also extend to other ABC transporters, offering a broader understanding of how similar mechanisms contribute to multidrug resistance in various diseases. This research not only highlights the importance of MTX1 in therapeutic contexts but also emphasizes the necessity for innovative approaches to tackle drug resistance in clinical settings.
