Analytical Data
-
Gene name
MIB1
- Application
-
Alternative Names
MIB1；DIP1；KIAA1323；ZZANK2；E3 ubiquitin-Protein ligase MIB1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86YT6
-
Expression Region
5-332aa
-
AA Sequence
RNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHLRHRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTEIQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQ
-
Molecular Weight
40.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MIB1 (Mindbomb E3 ubiquitin protein ligase 1) is an E3 ubiquitin ligase that plays a crucial role in the regulation of protein degradation and has been implicated in various cellular processes, including the Notch signaling pathway, which is essential for cell differentiation and development. The study of MIB1 is significant due to its involvement in multiple biological contexts, including embryogenesis, neurogenesis, and cancer progression. Mutations or dysregulation of MIB1 have been associated with tumorigenesis, making it a potential target for therapeutic interventions. Recent research has focused on understanding the molecular mechanisms by which MIB1 regulates substrate ubiquitination and its interactions with other cellular proteins. The production of recombinant MIB1 protein is vital for elucidating its structure-function relationship, as well as for in vitro functional assays to explore its role in ubiquitination and signaling pathways. Advances in recombinant DNA technology and protein expression systems have facilitated the generation of active MIB1, enabling researchers to investigate its enzymatic activity and regulatory roles in cellular contexts. Furthermore, understanding MIB1's function may provide insights into the development of novel cancer therapies and strategies to manipulate cell fate decisions. The investigation of MIB1 continues to be a dynamic area of research with significant implications for both basic biology and clinical applications.
