Cat: PA2000-3393

Recombinant Human BH0637 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BH0637

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BH0637;

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9KF49

  • Expression Region

    1-328aa

  • AA Sequence

    MCEQKYRWTKKQIRQQLAVVRGEMAPTLVLKNATYLNSVRGKWLDANIWI YQDRIVYVGQDMPAKLDDETEVVDCGQQVIVPGYIEHHAHPFQLYNPHSF ANYAAAMGTTTLINDNLMFFLALEKKKALSMIESLDELPSSMYWWCRYDP QTEMNDEEGHFLNSKIKEWLEHPLVVQGGELTSWPKVITGDDGILHWMQE TRRLRKPIEGHFPGASEKTLTQMSLLGVTSDHEAMTGEEVIRRLDLGYMT SLRHSSIRSDLAKILREMKELGIDDFSRCMLTTDGSPPSFYEQGIMDRLI KIALDEGIPPKDAYGMATYYVARYYGLD

  • Molecular Weight

    58 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The BH0637 recombinant protein has garnered significant interest in the field of molecular biology and biotechnology due to its potential applications in therapeutic development and industrial processes. It is derived from the bacterium Burkholderia cenocepacia, known for its ability to thrive in various environments, including those that are hostile to many organisms. Research into BH0637 has revealed its involvement in critical biological pathways, particularly those related to stress response and virulence factors in pathogenic strains. The protein's unique structure and functionality present opportunities for understanding its role in microbial pathogenesis, as well as its potential as a target for novel antimicrobial therapies. Furthermore, the recombinant production of BH0637 allows for the detailed study of its biochemical properties and interactions, paving the way for applications in drug design and synthetic biology. As the demand for innovative solutions to combat antibiotic resistance and emerging infectious diseases increases, the exploration of BH0637 and its mechanistic insights holds promise for contributing to advances in healthcare and biotechnology. Ongoing research aims to elucidate its specific functions and interactions within cellular systems, which may ultimately lead to new strategies for prevention and treatment of bacterial infections.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US