Analytical Data
-
Gene name
EXO5
- Application
-
Alternative Names
EXO5；C1orf176；DEM1；Exonuclease V
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H790
-
Expression Region
1-373aa
-
AA Sequence
MAETREEETVSAEASGFSDLSDSEFLEFLDLEDAQESKALVNMPGPSSESLGKDDKPISLQNWKRGLDILSPMERFHLKYLYVTDLATQNWCELQTAYGKELPGFLAPEKAAVLDTGASIHLARELELHDLVTVPVTTKEDAWAIKFLNILLLIPTLQSEGHIREFPVFGEGEGVLLVGVIDELHYTAKGELELAELKTRRRPMLPLEAQKKKDCFQVSLYKYIFDAMVQGKVTPASLIHHTKLCLEKPLGPSVLRHAQQGGFSVKSLGDLMELVFLSLTLSDLPVIDILKIEYIHQETATVLGTEIVAFKEKEVRAKVQHYMAYWMGHREPQGVDVEEAWKCRTCTYADICEWRKGSGVLSSTLAPQVKKAK
-
Molecular Weight
57.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EXO5 is a member of the exosome complex, a multi-protein assembly responsible for RNA processing and degradation. Researchers have turned their attention to EXO5 due to its critical role in maintaining cellular RNA homeostasis and its involvement in various physiological processes, including gene expression regulation, mitochondrial function, and stress responses. Understanding EXO5's structure and function is essential for elucidating the mechanisms underlying RNA metabolism and its implications in diseases, such as cancer and neurodegenerative disorders. The recombinant expression of EXO5 allows for detailed biochemical and biophysical studies, offering insights into its molecular interactions and enzymatic activities. These studies enhance our understanding of how EXO5 contributes to RNA turnover and stability, which is vital for developing therapeutic strategies targeting RNA-related pathologies. Furthermore, investigating the post-translational modifications and regulatory mechanisms of EXO5 can reveal its role in cellular signaling pathways, making it a potential biomarker or therapeutic target in diseases characterized by dysregulated RNA processing. Overall, the study of EXO5 recombinant protein not only advances the fundamental knowledge of RNA biology but also opens new avenues for therapeutic interventions in RNA-associated diseases.
