Analytical Data
-
Gene name
DDIT4L
- Application
-
Alternative Names
DDIT4L; REDD2; RTP801LDNA damage-inducible transcript 4-like protein; HIF-1 responsive protein RTP801-like; Protein regulated in development and DNA damage response 2; REDD-2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96D03
-
Expression Region
1-193aa
-
AA Sequence
MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS
-
Molecular Weight
48.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DDIT4L, also known as DNA damage-inducible transcript 4-like protein, is a member of the DDIT family, which plays a crucial role in cellular stress responses, particularly under conditions of hypoxia and nutrient deprivation. Research into DDIT4L is gaining momentum due to its potential implications in various pathological conditions, including cancer and metabolic disorders. Elevated DDIT4L expression has been associated with the regulation of the mTOR signaling pathway, a central pathway that modulates cell growth, proliferation, and survival based on nutrient availability. Dysregulation of this pathway is implicated in tumorigenesis, making DDIT4L a target of interest for therapeutic interventions. Furthermore, understanding the molecular mechanisms regulating DDIT4L expression and activity can provide insights into its role in metabolic stress responses and cellular adaptation. As a result, the functional characterization and recombinant expression of DDIT4L have become a focus of research efforts, facilitating the exploration of its biochemical properties, interactions, and regulatory pathways. This research not only enhances the understanding of DDIT4L’s function in cell biology but also lays the groundwork for developing novel strategies to manipulate its activity in disease contexts, thus underscoring its significance in both basic and applied biomedical research.
