Analytical Data
-
Gene name
NTCP
- Application
-
Alternative Names
NTCP；NTCP；Hepatic sodium/bile acid cotransporter
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14973
-
Expression Region
1-349aa
-
AA Sequence
MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
-
Molecular Weight
39.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of NTCP (Sodiumtaurocholate cotransporting polypeptide) recombinant proteins has gained significant attention due to their critical role in liver function and drug metabolism. NTCP is a key transporter in hepatocytes, facilitating the uptake of bile acids, which are essential for digestion and absorption of fats. Understanding NTCP's structure and function is vital for elucidating mechanisms of liver disease, bile acid homeostasis, and the pharmacokinetics of various drugs, especially those that are bile acid-dependent. Moreover, since NTCP serves as a receptor for certain viral infections, including hepatitis B virus (HBV), research into its recombinant proteins is crucial for developing therapeutic strategies against such infections. Recent advances in recombinant DNA technology have enabled researchers to produce NTCP proteins in a controlled environment, allowing for in-depth studies on their physiological and pathological roles. This research not only enhances our understanding of liver biology but also paves the way for innovative drug development and targeted therapies, making NTCP an important focus in both clinical and pharmaceutical research.
