Analytical Data
-
Gene name
NODAL
- Application
-
Alternative Names
NODAL;Nodal homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96S42
-
Expression Region
275-346aa
-
AA Sequence
RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSML YVDNGRVLLDHHKDMIVEECGC
-
Molecular Weight
34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NODAL is a crucial member of the TGF-β superfamily and plays a significant role in early embryonic development and the establishment of left-right asymmetry in vertebrates. It functions primarily as a morphogen, influencing cell fate decisions and promoting mesoderm formation and endoderm specification during gastrulation. NODAL's signaling pathway is mediated through its interaction with specific receptors, leading to the activation of SMAD proteins that regulate target gene expression. Dysregulation of NODAL signaling has been implicated in various developmental disorders and tumors, highlighting its importance in both normal physiology and disease states. Recent studies have focused on elucidating the mechanisms of NODAL signaling, its regulatory networks, and its potential as a therapeutic target in regenerative medicine and cancer therapy. Understanding the precise role of NODAL in embryogenesis and its implications in pathological conditions offers promising avenues for future research aimed at harnessing its biological functions for clinical applications.











