Cat: PA2000-3374

Recombinant Mouse Cltrn Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Cltrn

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Cltrn;TMEM27;Collectrin

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9ESG4

  • Expression Region

    15-141aa

  • AA Sequence

    ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP

  • Molecular Weight

    34.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Cltrn, or Clathrin, is a crucial protein involved in the endocytic process, where cells internalize molecules and receptors from their surface. This protein forms a characteristic "basket-like" structure that facilitates the formation of vesicles, enabling cellular communication and nutrient uptake. Recent studies have highlighted the importance of Cltrn in various physiological and pathological contexts, including its role in neurotransmitter release, signal transduction, and the internalization of certain pathogens. Moreover, dysregulation of Cltrn has been implicated in several diseases, such as neurodegenerative disorders and cancer. Understanding the molecular mechanisms of Cltrn function and its interactions with other cellular components is pivotal for developing therapeutic strategies. Researchers have focused on characterizing Cltrn's structure-function relationships through recombinant protein studies, which provide insights into its role in vesicle formation and trafficking. These findings contribute to our overall understanding of cell biology and may pave the way for novel interventions targeting Cltrn in disease states. This exploration underscores the significance of Cltrn not only in basic cellular processes but also in its potential as a therapeutic target in various medical conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US