Analytical Data
-
Gene name
SMG1
- Application
-
Alternative Names
61E3.4; ATX; hSMG-1; hSMG1; KIAA0421; Lambda interacting protein; Lambda-interacting protein; Lambda/iota protein kinase C interacting protein; Lambda/iota protein kinase C-interacting protein; LIP; Phosphatidylinositol 3 kinase related kinase; Phosphatidylinositol 3 kinase related protein kinase; PI 3 kinase related kinase SMG 1; Serine/threonine protein kinase SMG1; Serine/threonine-protein kinase SMG1; SMG-1; smg1; SMG1_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96Q15
-
Expression Region
2922-3031 aa
-
AA Sequence
PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV
-
Molecular Weight
37.84 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SMG1, a key protein in the nonsense-mediated mRNA decay (NMD) pathway, plays a critical role in cellular homeostasis by influencing gene expression and regulating the stability of mRNA transcripts. This pathway is essential for identifying and degrading mRNAs containing premature stop codons, thereby preventing the synthesis of truncated and potentially harmful proteins. Research into SMG1's structure and function has gained traction due to its implications in various disease states, including cancer and genetic disorders where NMD pathways are often dysregulated. Additionally, understanding the molecular mechanisms governing SMG1's interactions with other NMD factors can provide insights into its regulatory function in cellular processes. Recombining SMG1 in research allows for detailed exploration of its role in mRNA surveillance and potential therapeutic targets. Furthermore, studies have shown that alterations in SMG1 and its associated pathways can lead to significant changes in protein expression profiles, making it a focus for targeted therapies aimed at correcting the dysregulation of NMD. By elucidating the functional dynamics of SMG1 through recombinant technologies, researchers aim to develop strategies to modulate its activity, ultimately contributing to novel approaches in treating diseases linked to NMD dysfunction.
