Analytical Data
-
Gene name
Prss29
- Application
-
Alternative Names
Prss29；Isp2；Serine protease 29
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99MS4
-
Expression Region
18-279aa
-
AA Sequence
GTPAPGPEDVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAGNQGQDSCYGDAGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQMQRFS
-
Molecular Weight
43.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Prss29, also known as protease serine 29, is a member of the serine protease family, which plays a crucial role in various biological processes, including protein digestion, immune response, and cell signaling. The study of Prss29 has garnered attention due to its potential involvement in developmental processes and pathological conditions. Researchers have found that this enzyme is expressed in multiple tissues, including the pancreas, and may play a role in maintaining physiological functions related to inflammation and tissue remodeling. Abnormal expression levels of Prss29 have been associated with various diseases, including certain types of cancer, suggesting that it could serve as a biomarker for disease progression or a target for therapeutic interventions. The recombinant expression of Prss29 allows scientists to investigate its enzymatic activity, substrate specificity, and role in cellular mechanisms. Understanding the structure and function of Prss29 at the molecular level is essential for elucidating its biological significance and therapeutic potential. Overall, Prss29 represents a promising area of research within the field of proteomics and molecular biology, with implications for both basic research and clinical applications.
