Analytical Data
-
Gene name
Flt3
- Application
-
Alternative Names
Flt3;CD135;FLK2;STK1;Receptor-type tyrosine-Protein kinase FLT3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49771
-
Expression Region
27-184aa
-
AA Sequence
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGALWRL VLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTN ISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEA TAPTAPQP
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Flt3 (Fms-like tyrosine kinase 3) is a receptor tyrosine kinase primarily expressed in hematopoietic stem and progenitor cells, playing a crucial role in their proliferation, survival, and differentiation. Aberrant Flt3 signaling is implicated in various hematological malignancies, particularly acute myeloid leukemia (AML), where mutations leading to its constitutive activation are often found. Given its significance in leukemia pathogenesis, Flt3 has emerged as a promising therapeutic target, and the development of Flt3 inhibitors is an area of active research. Understanding the structural and functional properties of Flt3 through studies involving recombinant proteins is essential for designing targeted therapies. Recombinant Flt3 proteins can be used to investigate its activation mechanisms, assess binding affinities of various ligands, and identify potential inhibitors. Furthermore, these studies provide insights into the downstream signaling pathways activated by Flt3, contributing to a better understanding of hematopoiesis and leukemia. The exploration of Flt3's role in normal and malignant hematopoiesis is critical for developing novel therapies that can improve clinical outcomes for patients with Flt3-mutated leukemias. Overall, the research surrounding Flt3 recombinant proteins not only aids in elucidating the biological functions of this receptor but also holds potential for the advancement of targeted treatments in hematological cancers.











