Cat: PA1000-7780

Recombinant Human Flt3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Flt3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Flt3;CD135;FLK2;STK1;Receptor-type tyrosine-Protein kinase FLT3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P49771

  • Expression Region

    27-184aa

  • AA Sequence

    TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGALWRL VLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTN ISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEA TAPTAPQP

  • Molecular Weight

    18 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Flt3 (Fms-like tyrosine kinase 3) is a receptor tyrosine kinase primarily expressed in hematopoietic stem and progenitor cells, playing a crucial role in their proliferation, survival, and differentiation. Aberrant Flt3 signaling is implicated in various hematological malignancies, particularly acute myeloid leukemia (AML), where mutations leading to its constitutive activation are often found. Given its significance in leukemia pathogenesis, Flt3 has emerged as a promising therapeutic target, and the development of Flt3 inhibitors is an area of active research. Understanding the structural and functional properties of Flt3 through studies involving recombinant proteins is essential for designing targeted therapies. Recombinant Flt3 proteins can be used to investigate its activation mechanisms, assess binding affinities of various ligands, and identify potential inhibitors. Furthermore, these studies provide insights into the downstream signaling pathways activated by Flt3, contributing to a better understanding of hematopoiesis and leukemia. The exploration of Flt3's role in normal and malignant hematopoiesis is critical for developing novel therapies that can improve clinical outcomes for patients with Flt3-mutated leukemias. Overall, the research surrounding Flt3 recombinant proteins not only aids in elucidating the biological functions of this receptor but also holds potential for the advancement of targeted treatments in hematological cancers.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US