Analytical Data
-
Gene name
WDR77
- Application
-
Alternative Names
WDR77；MEP50；WD45；Methylosome Protein WDR77
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQA1
-
Expression Region
1-312aa
-
AA Sequence
MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLS GRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDS GAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIK VWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCP KPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLS SAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFV RDATWSPLNHSL
-
Molecular Weight
50 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WDR77, also known as WD repeat-containing protein 77, is a multi-functional protein that plays crucial roles in various cellular processes, including RNA processing, gene regulation, and signal transduction. It is characterized by the presence of WD repeat motifs, which are important for protein-protein interactions. Research has shown that WDR77 is involved in modifying the activity of certain transcription factors and is essential for the regulation of genes associated with development and cellular responses to stress. Alterations in WDR77 expression have been linked to a variety of diseases, including cancers, where it may contribute to tumorigenesis by affecting cell proliferation and survival. The study of recombinant WDR77 protein aims to elucidate its specific mechanisms of action at the molecular level, improve our understanding of its role in cellular pathways, and explore its potential as a therapeutic target. By producing and characterizing recombinant WDR77, researchers can investigate its interactions with other proteins and small molecules, providing insights necessary for the development of novel strategies to counteract the pathological effects associated with its dysregulation. Understanding WDR77's structure-function relationship and its implications in health and disease can pave the way for innovative treatments in oncology and regenerative medicine.
