Analytical Data
-
Gene name
HIST1H2BN
- Application
-
Alternative Names
HIST1H2BN；H2BFD；HIST1H2BN；Histone H2B type 1-N
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99877
-
Expression Region
2-126aa
-
AA Sequence
PEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
-
Molecular Weight
29.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HIST1H2BN is a member of the histone H2B family, which plays a critical role in the structure and function of chromatin. Histones, as essential proteins, are vital for the packaging of DNA into a compact, organized form, thus influencing gene expression and regulation. Recombination of the HIST1H2BN gene can lead to variations in histone protein composition, which may impact cellular processes such as transcription, DNA repair, and replication. Research into HIST1H2BN recombinant proteins is gaining momentum due to their potential implications in cancer biology and epigenetics, as aberrations in histone modifications are often associated with tumorigenesis and various diseases. By studying the structure, functionality, and interactions of the HIST1H2BN recombinant protein, researchers aim to uncover its specific contributions to chromatin dynamics and how alterations in its expression can influence cellular homeostasis and disease progression. Furthermore, understanding the precise role of HIST1H2BN may provide insights into novel therapeutic strategies targeting epigenetic changes in cancer and other disorders, highlighting the protein's significance in biomedical research. As such, investigations into HIST1H2BN and its recombinant forms not only enhance our understanding of chromatin biology but also open up avenues for potential clinical applications.
