Analytical Data
-
Gene name
SLC6A5
- Application
-
Alternative Names
Glycine transporter; Glycine transporter type 2; GlyT-2; GlyT2; NET1; SC6A5_HUMAN; SC6AC5; Slc6a5; SLC6A5 solute carrier family 6 neurotransmitter transporter. glycine member 5; Slc6a9; Sodium and chloride dependent glycine transporter 2; Sodium- and chloride-dependent glycine transporter 2; Solute carrier family 6 member 5; Solute carrier family 6 neurotransmitter transporter glycine member 5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y345
-
Expression Region
294-393 aa
-
AA Sequence
TLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIR
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC6A5, also known as the glycine transporter 2 (GlyT2), is an essential member of the SLC6 family of solute carriers, primarily responsible for the reuptake of glycine in the central nervous system. Glycine serves as an important inhibitory neurotransmitter, playing a crucial role in modulating synaptic transmission and maintaining excitatory-inhibitory balance in the brain. Dysregulation of glycine transporters has been implicated in various neurological disorders, including epilepsy, schizophrenia, and certain types of pain. The study of SLC6A5 and its recombinant protein is vital for understanding its function, regulation, and therapeutic potential. Researchers employ recombinant DNA technology to produce and analyze SLC6A5, allowing for detailed investigations into its structure and pharmacology. This enables the development of specific inhibitors that may mitigate the effects of dysregulation in glycinergic signaling. Furthermore, characterizing the interactions between SLC6A5 and other molecules can provide insights into its role within the synaptic environment. By elucidating the mechanisms underlying glycine transport and its implications in health and disease, the research on SLC6A5 recombinant protein promises to contribute significantly to the fields of neuropharmacology and the development of novel therapeutic strategies.
