Analytical Data
-
Gene name
CYP2C18
- Application
-
Alternative Names
CYP2C18Cytochrome P450 2C18; EC 1.14.14.1; CYPIIC18; Cytochrome P450-6b/29c
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P33260
-
Expression Region
1-490aa
-
AA Sequence
MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKVYGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRWKEIRRFCLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICSVIFHDRFDYKDQRFLNLMEKFNENLRILSSPWIQVCNNFPALIDYLPGSHNKIAENFAYIKSYVLERIKEHQESLDMNSARDFIDCFLIKMEQEKHNQQSEFTVESLIATVTDMFGAGTETTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYIDLLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFKKSDYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVPPLYQLCFIPV
-
Molecular Weight
82.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYP2C18 is a member of the cytochrome P450 superfamily, which plays a crucial role in the metabolism of various endogenous and exogenous compounds, including drugs and xenobiotics. The interest in recombinant CYP2C18 proteins has surged due to their potential implications in drug metabolism and toxicology. This enzyme is involved in the oxidation of a wide range of substrates, which affects the pharmacokinetics and pharmacodynamics of numerous therapeutic agents. Understanding the function and regulation of CYP2C18 is essential for predicting drug interactions and personalized medicine. Additionally, the expression of CYP2C18 in non-human systems allows researchers to investigate its biochemical properties and post-translational modifications, further elucidating its role in metabolic pathways. Advances in recombinant DNA technology and protein expression systems have enabled the production of CYP2C18 in various host systems, facilitating detailed studies that can contribute to drug design and development, as well as the assessment of drug safety. The investigation of CYP2C18 also addresses concerns related to inter-individual variability in drug response due to genetic polymorphisms affecting enzyme activity. Overall, research on CYP2C18 recombinant proteins is pivotal for enhancing our understanding of molecular pharmacology and improving therapeutic outcomes in clinical settings.
